Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcium-dependent protein kinase 1
LigandBDBM50132260
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774239
Kd>10000±n/a nM
Citation Davis, MIHunt, JPHerrgard, SCiceri, PWodicka, LMPallares, GHocker, MTreiber, DKZarrinkar, PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calcium-dependent protein kinase 1
Name:Calcium-dependent protein kinase 1
Synonyms:Calcium-dependent protein kinase 1 | PfCDPK1
Type:PROTEIN
Mol. Mass.:60804.87
Organism:Plasmodium Falciparum
Description:P62343
Residue:524
Sequence:
MGCSQSSNVKDFKTRRSKFTNGNNYGKSGNNKNSEDLAINPGMYVRKKEGKIGESYFKVR
KLGSGAYGEVLLCREKHGHGEKAIKVIKKSQFDKMKYSITNKIECDDKIHEEIYNEISLL
KSLDHPNIIKLFDVFEDKKYFYLVTEFYEGGELFEQIINRHKFDECDAANIMKQILSGIC
YLHKHNIVHRDIKPENILLENKHSLLNIKIVDFGLSSFFSKDNKLRDRLGTAYYIAPEVL
RKKYNEKCDVWSCGVILYILLCGYPPFGGQNDQDIIKKVEKGKYYFDFNDWKNISEEAKE
LIKLMLTYDYNKRITAKEALNSKWIKKYANNINKSDQKTLCGALSNMRKFEGSQKLAQAA
ILFIGSKLTTLEERKELTDIFKKLDKNGDGQLDKKELIEGYNILRSFKNELGELKNVEEE
VDNILKEVDFDKNGYIEYSEFISVCMDKQILFSEERLRDAFNLFDTDKSGKITKEELANL
FGLTSISEQMWNEVLGEADKNKDNMIDFDEFVNMMHKICDNKSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50132260
NameBDBM50132260
Synonyms:2-(2-Chloro-4-iodo-phenylamino)-N-cyclopropylmethoxy-3,4-difluoro-benzamide | 2-(2-chloro-4-iodophenylamino)-N-(cyclopropylmethoxy)-3,4-difluorobenzamide | CHEMBL105442 | CI-1040 | PD-18435 | PD-184352 | US8575391, 341
TypeSmall organic molecule
Emp. Form.C17H14ClF2IN2O2
Mol. Mass.478.66
SMILESFc1ccc(C(=O)NOCC2CC2)c(Nc2ccc(I)cc2Cl)c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a