Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target14-3-3 protein sigma
LigandBDBM50356015
Substrate/Competitorn/a
Meas. Tech.ChEMBL_775356
Kd>1000±n/a nM
Citation Corradi, VMancini, MSantucci, MACarlomagno, TSanfelice, DMori, MVignaroli, GFalchi, FManetti, FRadi, MBotta, M Computational techniques are valuable tools for the discovery of protein-protein interaction inhibitors: the 14-3-3s case. Bioorg Med Chem Lett21:6867-71 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
14-3-3 protein sigma
Name:14-3-3 protein sigma
Synonyms:Epithelial cell marker protein 1 | Stratifin
Type:PROTEIN
Mol. Mass.:27757.12
Organism:Homo sapiens (Human)
Description:ChEMBL_775356
Residue:248
Sequence:
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWR
VLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFY
LKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFH
YEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGG
EAPQEPQS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50356015
NameBDBM50356015
Synonyms:CHEMBL1911376
TypeSmall organic molecule
Emp. Form.C20H21N3O8
Mol. Mass.431.396
SMILESCCCCCCOC(=O)c1ccc(Nc2c(cc(cc2[N+]([O-])=O)C(O)=O)[N+]([O-])=O)cc1
Structure
n/a