Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcitonin gene-related peptide (CGRP alpha)
LigandBDBM50356278
Substrate/Competitorn/a
Meas. Tech.ChEMBL_775007
Ki 7500±n/a nM
Citation Zartman, CBBell, IMGallicchio, SNGraham, SLKane, SAMallee, JJRutledge, RZSalvatore, CAVacca, JPWilliams, TM Identification of a novel RAMP-independent CGRP receptor antagonist. Bioorg Med Chem Lett21:6705-8 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calcitonin gene-related peptide (CGRP alpha)
Name:Calcitonin gene-related peptide (CGRP alpha)
Synonyms:CGRP | Calcitonin gene-related peptide 1
Type:Enzyme
Mol. Mass.:13902.80
Organism:Homo sapiens (Human)
Description:P06881
Residue:128
Sequence:
MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQNYVQ
MKASELEQEQEREGSRIIAQKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAFG
RRRRDLQA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50356278
NameBDBM50356278
Synonyms:CHEMBL1910947
TypeSmall organic molecule
Emp. Form.C17H16BrF2N3O4S
Mol. Mass.476.292
SMILESOc1c(Br)cc(nc1C(=O)NCc1cc(F)cc(F)c1)N1CCCCS1(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a