Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProton-coupled amino acid transporter 1
LigandBDBM50000109
Substrate/Competitorn/a
Meas. Tech.ChEMBL_788189
Ki 19000000±n/a nM
Citation Thondorf, IVoigt, VSchäfer, SGebauer, SZebisch, KLaug, LBrandsch, M Three-dimensional quantitative structure-activity relationship analyses of substrates of the human proton-coupled amino acid transporter 1 (hPAT1). Bioorg Med Chem19:6409-18 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Proton-coupled amino acid transporter 1
Name:Proton-coupled amino acid transporter 1
Synonyms:Proton/amino acid transporter 1 | Solute carrier family 36 member 1 | hPAT1
Type:PROTEIN
Mol. Mass.:53078.06
Organism:Homo sapiens (Human)
Description:ChEMBL_788189
Residue:476
Sequence:
MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWFQTLIHLLKGN
IGTGLLGLPLAVKNAGIVMGPISLLIIGIVAVHCMGILVKCAHHFCRRLNKSFVDYGDTV
MYGLESSPCSWLRNHAHWGRRVVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTNNC
HNNETVILTPTMDSRLYMLSFLPFLVLLVFIRNLRALSIFSLLANITMLVSLVMIYQFIV
QRIPDPSHLPLVAPWKTYPLFFGTAIFSFEGIGMVLPLENKMKDPRKFPLILYLGMVIVT
ILYISLGCLGYLQFGANIQGSITLNLPNCWLYQSVKLLYSIGIFFTYALQFYVPAEIIIP
FFVSRAPEHCELVVDLFVRTVLVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLLE
VTTFYSEGMSPLTIFKDALISILGFVGFVVGTYEALYELIQPSNAPIFINSTCAFI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50000109
NameBDBM50000109
Synonyms:(2R)-2-aminopropanoic acid | (R)-2-aminopropanoic acid | (R)-alanine | CHEMBL66693 | D-Alanin | D-alanine | D-alpha-alanine | D-alpha-aminopropionic acid
TypeSmall organic molecule
Emp. Form.C3H7NO2
Mol. Mass.89.0932
SMILESC[C@@H](N)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a