Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEstradiol 17-beta-dehydrogenase 2
LigandBDBM50357463
Substrate/Competitorn/a
Meas. Tech.ChEMBL_787302
IC50 31±n/a nM
Citation Wetzel, MMarchais-Oberwinkler, SPerspicace, EMöller, GAdamski, JHartmann, RW Introduction of an electron withdrawing group on the hydroxyphenylnaphthol scaffold improves the potency of 17ß-hydroxysteroid dehydrogenase type 2 (17ß-HSD2) inhibitors. J Med Chem54:7547-57 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Estradiol 17-beta-dehydrogenase 2
Name:Estradiol 17-beta-dehydrogenase 2
Synonyms:17-beta-Hydroxysteroid Dehydrogenase 2 (17-beta-HSD2) | 20 alpha-hydroxysteroid dehydrogenase | 20-alpha-HSD | Estradiol 17-beta-dehydrogenase 2 (17beta-HSD2) | Microsomal 17-beta-hydroxysteroid dehydrogenas | Testosterone 17-beta-dehydrogenase
Type:Oxidoreductase; single-pass type II membrane protein
Mol. Mass.:42795.29
Organism:Homo sapiens (Human)
Description:Enzyme was partially purified from human placenta.
Residue:387
Sequence:
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLIL
FSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPG
AEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELL
LMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVT
MFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI
LAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYD
YFAKRHFGQDKPMPRALRMPNYKKKAT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50357463
NameBDBM50357463
Synonyms:CHEMBL1917897
TypeSmall organic molecule
Emp. Form.C17H11F3O2
Mol. Mass.304.2632
SMILESOc1ccc(cc1C(F)(F)F)-c1ccc2c(O)cccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a