Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLaccase
LigandBDBM26985
Substrate/Competitorn/a
Meas. Tech.ChEMBL_786156
IC50 257000±n/a nM
Citation Dalisay, DSSaludes, JPMolinski, TF Ptilomycalin A inhibits laccase and melanization in Cryptococcus neoformans. Bioorg Med Chem19:6654-7 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Laccase
Name:Laccase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:55472.53
Organism:Trametes versicolor
Description:ChEMBL_786157
Residue:520
Sequence:
MSRFHSLLAFVVASLAAVAHAGIGPVADLTITNAAVSPDGFSRQAVVVNGGTPGPLITGN
MGDRFQLNVIDNLTDHTMLKSTSIHWHGFFQKGTNWADGPAFINQCPISSGHSFLYDFQV
PDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPAADLYDVDNDDTVITLADWYHVAAKLG
PAFPLGADATLINGKGRSPSTTTADLTVISVTPGKRYRFRLVSLSCDPNHTFSIDGHNMT
IIETDSINTAPLVVDSIQIFAAQRYSFVLEANQAVDNYWIRANPSFGNVGFTGGINSAIL
RYDGAAAIEPTTTQTTSTEPLNEVNLHPLVATAVPGSPAAGGVDLAINMAFNFNGTNFFI
NGASFTPPTVPVLLQIISGAQNAQDLLPSGSVYSLPSNADIEISFPATAAAPGAPHPFHL
HGHAFAVVRSAGSTVYNYDNPIFRDVVSTGTPAAGDNVTIRFRTDNPGPWFLHCHIDFHL
EAGFAVVFAEDIPDVASANPVPQAWSDLCPTYDARDPSDQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26985
NameBDBM26985
Synonyms:2-triaza-1,2-diyne | CHEMBL79455 | CHEMBL89295 | N3(-1) | azide
TypeIon
Emp. Form.N3
Mol. Mass.42.0206
SMILES[N-]=[N+]=[N-]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a