Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLaccase
LigandBDBM50357700
Substrate/Competitorn/a
Meas. Tech.ChEMBL_786157
IC50 5800±n/a nM
Citation Dalisay, DSSaludes, JPMolinski, TF Ptilomycalin A inhibits laccase and melanization in Cryptococcus neoformans. Bioorg Med Chem19:6654-7 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Laccase
Name:Laccase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:55472.53
Organism:Trametes versicolor
Description:ChEMBL_786157
Residue:520
Sequence:
MSRFHSLLAFVVASLAAVAHAGIGPVADLTITNAAVSPDGFSRQAVVVNGGTPGPLITGN
MGDRFQLNVIDNLTDHTMLKSTSIHWHGFFQKGTNWADGPAFINQCPISSGHSFLYDFQV
PDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPAADLYDVDNDDTVITLADWYHVAAKLG
PAFPLGADATLINGKGRSPSTTTADLTVISVTPGKRYRFRLVSLSCDPNHTFSIDGHNMT
IIETDSINTAPLVVDSIQIFAAQRYSFVLEANQAVDNYWIRANPSFGNVGFTGGINSAIL
RYDGAAAIEPTTTQTTSTEPLNEVNLHPLVATAVPGSPAAGGVDLAINMAFNFNGTNFFI
NGASFTPPTVPVLLQIISGAQNAQDLLPSGSVYSLPSNADIEISFPATAAAPGAPHPFHL
HGHAFAVVRSAGSTVYNYDNPIFRDVVSTGTPAAGDNVTIRFRTDNPGPWFLHCHIDFHL
EAGFAVVFAEDIPDVASANPVPQAWSDLCPTYDARDPSDQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50357700
NameBDBM50357700
Synonyms:PTILOMYCALIN A
TypeSmall organic molecule
Emp. Form.C45H83N6O5
Mol. Mass.788.1772
SMILESCC[C@H]1CCCC[C@@]2(C[C@@H]3CC[C@@H]4[C@H](C(=O)OCCCCCCCCCCCCCCCC(=O)N(CCCN)CCCCN)[C@]5(CCC[C@@H](C)O5)NC(N2)=[N+]34)O1 |r,t:55|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a