Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInduced myeloid leukemia cell differentiation protein Mcl-1 homolog
LigandBDBM21400
Substrate/Competitorn/a
Meas. Tech.ChEMBL_785797
Kd>1000±n/a nM
Citation Goreshnik, IBrock, AMMaly, DJ Biochemical and pharmacological profiling of the pro-survival protein Bcl-xL. Bioorg Med Chem Lett21:4951-5 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Induced myeloid leukemia cell differentiation protein Mcl-1 homolog
Name:Induced myeloid leukemia cell differentiation protein Mcl-1 homolog
Synonyms:Bcl-2-related protein EAT/mcl1 | Mcl-1
Type:Developmental protein
Mol. Mass.:35215.08
Organism:Mus musculus (Mouse)
Description:n/a
Residue:331
Sequence:
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARP
PPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPA
VLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPL
GEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVT
NWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFF
HVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21400
NameBDBM21400
Synonyms:CHEMBL192571 | N-[(4-{[(2R)-4-(dimethylamino)-1-(phenylsulfanyl)butan-2-yl]amino}-3-nitrobenzene)sulfonyl]-4-(4,4-dimethylpiperidin-1-yl)benzamide | Phenylpiperidine, 1a
TypeSmall organic molecule
Emp. Form.C32H41N5O5S2
Mol. Mass.639.828
SMILESCN(C)CC[C@H](CSc1ccccc1)Nc1ccc(cc1[N+]([O-])=O)S(=O)(=O)NC(=O)c1ccc(cc1)N1CCC(C)(C)CC1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a