Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 5 (MC5R)
LigandBDBM50358562
Substrate/Competitorn/a
Meas. Tech.ChEMBL_790330
Ki 0.76±n/a nM
Citation Barkey, NMTafreshi, NKJosan, JSDe Silva, CRSill, KNHruby, VJGillies, RJMorse, DLVagner, J Development of melanoma-targeted polymer micelles by conjugation of a melanocortin 1 receptor (MC1R) specific ligand. J Med Chem54:8078-84 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 5 (MC5R)
Name:Melanocortin receptor (M4 and M5)
Synonyms:MC-2 | MC5-R | MC5R | Melanocortin MC5 | Melanocortin receptor 5
Type:Enzyme
Mol. Mass.:36612.92
Organism:Homo sapiens (Human)
Description:P33032
Residue:325
Sequence:
MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50358562
NameBDBM50358562
Synonyms:CHEMBL1923665
TypeSmall organic molecule
Emp. Form.C79H104N22O15
Mol. Mass.1601.8095
SMILESCCCC[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(C)C)C(=O)NCC(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@H](Cc1ccc2ccccc2c1)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(N)=O |r,wU:8.8,90.95,wD:12.12,4.4,32.32,42.43,57.60,68.71,82.87,101.106,(4.17,-29.27,;2.84,-28.5,;2.84,-26.97,;1.5,-26.19,;1.5,-24.66,;.18,-23.88,;-1.16,-24.65,;-1.16,-26.2,;-2.5,-23.89,;-3.83,-24.66,;-5.16,-23.89,;-5.16,-22.35,;-6.5,-24.66,;-7.83,-23.89,;-6.5,-26.2,;-5.16,-26.97,;-3.83,-26.2,;-2.49,-26.96,;-2.49,-28.5,;-1.15,-29.27,;-3.83,-29.28,;-5.16,-28.51,;-2.5,-22.34,;-1.16,-21.57,;-3.83,-21.58,;2.84,-23.88,;2.84,-22.34,;4.17,-24.65,;5.51,-23.88,;6.84,-24.65,;6.84,-26.18,;8.17,-23.87,;9.5,-24.64,;9.5,-26.18,;10.84,-26.95,;12.31,-26.46,;13.22,-27.7,;12.32,-28.96,;10.85,-28.49,;10.84,-23.87,;10.84,-22.33,;12.18,-24.64,;13.51,-23.87,;13.51,-22.33,;14.27,-20.99,;13.48,-19.67,;14.23,-18.33,;15.78,-18.31,;16.53,-16.98,;18.07,-16.95,;18.86,-18.28,;18.1,-19.62,;16.56,-19.64,;15.81,-20.98,;14.84,-24.64,;14.84,-26.18,;16.17,-23.87,;17.51,-24.63,;17.51,-26.17,;18.85,-26.94,;18.85,-28.48,;20.18,-29.25,;20.18,-30.79,;18.85,-31.55,;21.52,-31.56,;18.85,-23.86,;18.85,-22.32,;20.18,-24.63,;21.51,-23.86,;21.51,-22.31,;22.84,-21.55,;24.09,-22.45,;25.34,-21.55,;24.86,-20.08,;25.63,-18.74,;24.86,-17.41,;23.32,-17.41,;22.55,-18.75,;23.32,-20.08,;22.84,-24.62,;22.84,-26.16,;24.18,-23.85,;25.51,-24.62,;25.51,-26.16,;26.85,-26.94,;28.18,-26.16,;26.85,-28.47,;26.85,-23.85,;26.85,-22.31,;28.18,-24.62,;29.52,-23.85,;29.52,-22.3,;30.85,-21.54,;30.85,-19.99,;32.18,-19.22,;32.18,-17.68,;30.84,-16.91,;33.51,-16.91,;30.85,-24.62,;30.85,-26.15,;32.19,-23.84,;33.51,-24.61,;33.51,-26.15,;34.85,-26.92,;36.18,-26.15,;37.52,-26.92,;37.52,-28.46,;36.19,-29.23,;34.86,-28.46,;34.85,-23.84,;34.85,-22.29,;36.19,-24.61,;37.52,-23.83,;38.85,-24.61,;40.19,-23.84,;38.85,-26.15,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a