Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 5 (MC5R)
LigandBDBM50358565
Substrate/Competitorn/a
Meas. Tech.ChEMBL_790330
Ki 3.9±n/a nM
Citation Barkey, NMTafreshi, NKJosan, JSDe Silva, CRSill, KNHruby, VJGillies, RJMorse, DLVagner, J Development of melanoma-targeted polymer micelles by conjugation of a melanocortin 1 receptor (MC1R) specific ligand. J Med Chem54:8078-84 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 5 (MC5R)
Name:Melanocortin receptor (M4 and M5)
Synonyms:MC-2 | MC5-R | MC5R | Melanocortin MC5 | Melanocortin receptor 5
Type:Enzyme
Mol. Mass.:36612.92
Organism:Homo sapiens (Human)
Description:P33032
Residue:325
Sequence:
MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50358565
NameBDBM50358565
Synonyms:CHEMBL1923668
TypeSmall organic molecule
Emp. Form.C89H121N23O17
Mol. Mass.1785.0569
SMILESCCCC[C@H](NC(=O)[C@@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)CCCCNC(=O)CCCC#C)C(C)C)C(=O)NCC(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@H](Cc1ccc2ccccc2c1)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@H](Cc1ccccc1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(N)=O |r,wU:4.4,48.48,58.59,73.76,84.87,95.99,114.118,12.21,wD:103.107,24.25,8.8,(4.96,-14.18,;3.63,-14.95,;3.63,-16.49,;2.3,-17.26,;2.3,-18.8,;.96,-19.58,;-.38,-18.8,;-.38,-17.26,;-1.71,-19.58,;-3.05,-18.8,;-4.39,-19.58,;-4.39,-21.11,;-5.72,-18.8,;-5.72,-17.26,;-4.39,-16.49,;-3.05,-17.26,;-1.71,-16.49,;-1.71,-14.95,;-.38,-14.17,;-3.05,-14.17,;-4.39,-14.95,;-7.06,-19.58,;-8.39,-18.81,;-8.4,-17.28,;-9.72,-19.59,;-11.06,-18.82,;-9.72,-21.12,;-8.38,-21.89,;-8.38,-23.43,;-7.04,-24.19,;-7.04,-25.73,;-5.7,-26.49,;-5.7,-28.03,;-4.37,-25.72,;-3.04,-26.48,;-1.71,-25.71,;-.38,-26.47,;.95,-27.24,;-1.71,-21.11,;-.38,-21.89,;-3.05,-21.89,;3.63,-19.58,;3.63,-21.11,;4.97,-18.8,;6.3,-19.58,;7.63,-18.8,;7.63,-17.26,;8.98,-19.58,;10.31,-18.8,;10.31,-17.26,;11.65,-16.49,;13.12,-16.94,;14.01,-15.69,;13.08,-14.45,;11.63,-14.94,;11.65,-19.58,;11.65,-21.11,;12.98,-18.8,;14.32,-19.58,;14.32,-21.11,;13.54,-22.44,;12.01,-22.42,;11.23,-23.74,;11.99,-25.07,;11.21,-26.4,;11.98,-27.74,;13.52,-27.74,;14.29,-26.41,;13.53,-25.08,;14.3,-23.76,;15.66,-18.8,;15.66,-17.26,;16.99,-19.58,;18.32,-18.8,;18.32,-17.26,;19.67,-16.49,;19.67,-14.95,;21,-14.17,;21,-12.63,;19.67,-11.86,;22.33,-11.86,;19.67,-19.58,;19.67,-21.11,;21,-18.8,;22.33,-19.58,;22.33,-21.11,;23.67,-21.89,;25.01,-21.11,;26.35,-21.89,;26.35,-23.43,;25.01,-24.21,;23.67,-23.43,;23.67,-18.8,;23.67,-17.26,;25.01,-19.58,;26.35,-18.8,;26.35,-17.26,;27.68,-16.49,;29.01,-17.26,;27.68,-14.95,;27.68,-19.58,;27.68,-21.11,;29.01,-18.8,;30.36,-19.58,;30.36,-21.11,;31.69,-21.89,;31.69,-23.43,;33.02,-24.21,;33.02,-25.74,;31.69,-26.52,;34.36,-26.52,;31.69,-18.8,;31.69,-17.26,;33.02,-19.58,;34.36,-18.8,;34.36,-17.26,;35.69,-16.49,;37.04,-17.26,;38.37,-16.49,;38.37,-14.95,;37.04,-14.17,;35.69,-14.95,;35.69,-19.58,;35.69,-21.11,;37.04,-18.8,;38.37,-19.58,;39.7,-18.8,;41.04,-19.58,;39.7,-17.26,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a