Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetchemokine (C-X-C motif) receptor 3
LigandBDBM50358629
Substrate/Competitorn/a
Meas. Tech.ChEMBL_789428
IC50 1.2±n/a nM
Citation Kim, SHAnilkumar, GNZawacki, LGZeng, QYang, DYShao, YDong, GXu, XYu, WJiang, YJenh, CHHall, JWCarroll, CDHobbs, DWBaldwin, JJMcGuinness, BFRosenblum, SBKozlowski, JAShankar, BBShih, NY III. Identification of novel CXCR3 chemokine receptor antagonists with a pyrazinyl-piperazinyl-piperidine scaffold. Bioorg Med Chem Lett21:6982-6 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
chemokine (C-X-C motif) receptor 3
Name:chemokine (C-X-C motif) receptor 3
Synonyms:AAO92295.1 | C-X-C chemokine receptor type 3 | C-X-C chemokine receptor type 3 (CXCR3) | C-X-C chemokine receptor type 3 (CXCR3A) | CXCR3A
Type:Enzyme Catalytic Domain
Mol. Mass.:40665.65
Organism:Homo sapiens (Human)
Description:n/a
Residue:368
Sequence:
MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALY
SLLFLLGLLGNGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFG
SGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCL
LFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILA
VLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK
SVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSET
SEASYSGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50358629
NameBDBM50358629
Synonyms:CHEMBL1921878
TypeSmall organic molecule
Emp. Form.C25H32Cl2N8O2
Mol. Mass.547.48
SMILESCC[C@H]1CN(CCN1C1CCN(CC1)C(=O)c1ccc(Cl)nc1N)c1ncc(nc1Cl)C(=O)NC1CC1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a