Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNADPH oxidase 1
LigandBDBM50359520
Substrate/Competitorn/a
Meas. Tech.ChEMBL_792877
Ki 217±n/a nM
Citation Gaggini, FLaleu, BOrchard, MFioraso-Cartier, LCagnon, LHoungninou-Molango, SGradia, ADuboux, GMerlot, CHeitz, FSzyndralewiez, CPage, P Design, synthesis and biological activity of original pyrazolo-pyrido-diazepine, -pyrazine and -oxazine dione derivatives as novel dual Nox4/Nox1 inhibitors. Bioorg Med Chem19:6989-99 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
NADPH oxidase 1
Name:NADPH oxidase 1
Synonyms:MOX-1 | MOX1 | Mitogenic oxidase 1 | NADH/NADPH mitogenic oxidase subunit P65-MOX | NOH-1 | NOH1 | NOX-1 | NOX1
Type:PROTEIN
Mol. Mass.:64890.44
Organism:Homo sapiens (Human)
Description:ChEMBL_792877
Residue:564
Sequence:
MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCL
NFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHL
FNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVI
MTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHP
RKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKV
VMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGD
WTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYK
FQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSN
IVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSL
RKCCHRYSSLDPRKVQFYFNKENF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50359520
NameBDBM50359520
Synonyms:CHEMBL1927158
TypeSmall organic molecule
Emp. Form.C23H23N5O3
Mol. Mass.417.4604
SMILESCOc1ccccc1-n1[nH]c2cc(=O)n3CCCN(Cc4ccccn4)Cc3c2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a