Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome b-245 heavy chain
LigandBDBM50359534
Substrate/Competitorn/a
Meas. Tech.ChEMBL_792878
Ki 1020±n/a nM
Citation Gaggini, FLaleu, BOrchard, MFioraso-Cartier, LCagnon, LHoungninou-Molango, SGradia, ADuboux, GMerlot, CHeitz, FSzyndralewiez, CPage, P Design, synthesis and biological activity of original pyrazolo-pyrido-diazepine, -pyrazine and -oxazine dione derivatives as novel dual Nox4/Nox1 inhibitors. Bioorg Med Chem19:6989-99 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome b-245 heavy chain
Name:Cytochrome b-245 heavy chain
Synonyms:CGD91-phox | Cytochrome b(558) subunit beta | Cytochrome b-245, beta polypeptide [Homo sapiens] | Cytochrome b558 subunit beta | Heme-binding membrane glycoprotein gp91phox | NADPH oxidase 2 | NADPH oxidase 2 (NOX2) | NOX2 | Neutrophil cytochrome b 91 kDa polypeptide | Superoxide-generating NADPH oxidase heavy chain subunit | gp91-1 | gp91-phox | p22 phagocyte B-cytochrome
Type:Enzyme
Mol. Mass.:65355.82
Organism:Homo sapiens (Human)
Description:P04839
Residue:570
Sequence:
MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACL
NFNCMLILLPVCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHL
FNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGV
VITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLAVHN
ITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKV
VTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGD
WTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL
KSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYL
TGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPE
ALAETLSKQSISNSESGPRGVHFIFNKENF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50359534
NameBDBM50359534
Synonyms:CHEMBL1927155
TypeSmall organic molecule
Emp. Form.C21H19ClN4O3
Mol. Mass.410.854
SMILESClc1ccccc1-n1[nH]c2cc(=O)n3CCCN(Cc4ccoc4)Cc3c2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a