Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNADPH oxidase 4
LigandBDBM50359528
Substrate/Competitorn/a
Meas. Tech.ChEMBL_792879
Ki 76±n/a nM
Citation Gaggini, FLaleu, BOrchard, MFioraso-Cartier, LCagnon, LHoungninou-Molango, SGradia, ADuboux, GMerlot, CHeitz, FSzyndralewiez, CPage, P Design, synthesis and biological activity of original pyrazolo-pyrido-diazepine, -pyrazine and -oxazine dione derivatives as novel dual Nox4/Nox1 inhibitors. Bioorg Med Chem19:6989-99 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
NADPH oxidase 4
Name:NADPH oxidase 4
Synonyms:KOX-1 | Kidney oxidase-1 | Kidney superoxide-producing NADPH oxidase | NOX4 | RENOX | Renal NAD(P)H-oxidase
Type:PROTEIN
Mol. Mass.:66954.54
Organism:Homo sapiens (Human)
Description:ChEMBL_792879
Residue:578
Sequence:
MAVSWRSWLANEGVKHLCLFIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRAS
ASVLNLNCSLILLPMCRTLLAYLRGSQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHV
AAHLVNALNFSVNYSEDFVELNAARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTY
AIRVSNYDIFWYTHNLFFVFYMLLTLHVSGGLLKYQTNLDTHPPGCISLNRTSSQNISLP
EYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLY
RYIRSNKPVTIISVMSHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCP
TETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEES
LNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLH
NKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGK
TVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50359528
NameBDBM50359528
Synonyms:CHEMBL1927149
TypeSmall organic molecule
Emp. Form.C23H20Cl2N4O2
Mol. Mass.455.337
SMILESClc1ccccc1CN1CCCn2c(C1)c1c(cc2=O)[nH]n(-c2ccccc2Cl)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a