Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50419553
Substrate/Competitorn/a
Meas. Tech.ChEMBL_792210
Ki 566±n/a nM
Citation Ferorelli, SAbate, CPedone, MPColabufo, NAContino, MPerrone, RBerardi, F Synthesis and binding assays of novel 3,3-dimethylpiperidine derivatives with various lipophilicities ass¿? receptor ligands. Bioorg Med Chem19:7612-22 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma-1 receptor
Synonyms:OPRS1 | SIGMAR1 | Sigma 1-type opioid receptor | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein
Type:Protein
Mol. Mass.:25307.17
Organism:Cavia porcellus (Guinea pig)
Description:Q60492
Residue:223
Sequence:
MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50419553
NameBDBM50419553
Synonyms:CHEMBL1929428
TypeSmall organic molecule
Emp. Form.C16H23N3S
Mol. Mass.289.439
SMILESCC1(C)CCCN(CCNc2nc3ccccc3s2)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a