Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Chk1
LigandBDBM50359810
Substrate/Competitorn/a
Meas. Tech.ChEMBL_791990
IC50 3.8±n/a nM
Citation Reader, JCMatthews, TPKlair, SCheung, KMScanlon, JProisy, NAddison, GEllard, JPiton, NTaylor, SCherry, MFisher, MBoxall, KBurns, SWalton, MIWestwood, IMHayes, AEve, PValenti, Mde Haven Brandon, ABox, Gvan Montfort, RLWilliams, DHAherne, GWRaynaud, FIEccles, SAGarrett, MDCollins, I Structure-guided evolution of potent and selective CHK1 inhibitors through scaffold morphing. J Med Chem54:8328-42 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Chk1
Name:Serine/threonine-protein kinase Chk1/2
Synonyms:CHK1 checkpoint homolog | Checkpoint kinase-1 (CHK1) | Serine/threonine-protein kinase Chk1
Type:Enzyme Catalytic Domain
Mol. Mass.:54443.02
Organism:Homo sapiens (Human)
Description:gi_166295192
Residue:476
Sequence:
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLK
RREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50359810
NameBDBM50359810
Synonyms:CHEMBL1928701
TypeSmall organic molecule
Emp. Form.C19H17ClN6O
Mol. Mass.380.831
SMILESClc1cccc2cc(Nc3cnc(C#N)c(OC4CCCNC4)n3)ncc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a