Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlucagon receptor
LigandBDBM50360598
Substrate/Competitorn/a
Meas. Tech.ChEMBL_795440
Ki 48±n/a nM
Citation Filipski, KJBian, JEbner, DCLee, ECLi, JCSammons, MFWright, SWStevens, BDDidiuk, MTTu, MPerreault, CBrown, JAtkinson, KTan, BSalatto, CTLitchfield, JPfefferkorn, JAGuzman-Perez, A A novel series of glucagon receptor antagonists with reduced molecular weight and lipophilicity. Bioorg Med Chem Lett22:415-20 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glucagon receptor
Name:Glucagon receptor
Synonyms:GL-R | Glucagon Receptor (GCGR) | Glucagon receptor (GlucR)
Type:Enzyme
Mol. Mass.:54026.92
Organism:Homo sapiens (Human)
Description:P47871
Residue:477
Sequence:
MPPCQPQRPLLLLLLLLACQPQVPSAQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNR
TFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQ
CQMDGEEIEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAIHANL
FASFVLKASSVLVIDGLLRTRYSQKIGDDLSVSTWLSDGAVAGCRVAAVFMQYGIVANYC
WLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDN
MGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGV
HEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRL
GKVLWEERNTSNHRASSSPGHGPPSKELQFGRGGGSQDSSAETPLAGGLPRLAESPF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50360598
NameBDBM50360598
Synonyms:CHEMBL1933364
TypeSmall organic molecule
Emp. Form.C24H22F6N4O3
Mol. Mass.528.4469
SMILESOC(=O)CCNC(=O)c1ccc(cc1)C(CCC(F)(F)F)Nc1cnn(c1)-c1ccc(cc1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a