Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGastric inhibitory polypeptide receptor
LigandBDBM50360599
Substrate/Competitorn/a
Meas. Tech.ChEMBL_795449
Ki 927±n/a nM
Citation Filipski, KJBian, JEbner, DCLee, ECLi, JCSammons, MFWright, SWStevens, BDDidiuk, MTTu, MPerreault, CBrown, JAtkinson, KTan, BSalatto, CTLitchfield, JPfefferkorn, JAGuzman-Perez, A A novel series of glucagon receptor antagonists with reduced molecular weight and lipophilicity. Bioorg Med Chem Lett22:415-20 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gastric inhibitory polypeptide receptor
Name:Gastric inhibitory polypeptide receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:53173.82
Organism:Homo sapiens (Human)
Description:ChEMBL_1518286
Residue:466
Sequence:
MTTSPILQLLLRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLA
CNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCEN
PEKNEAFLDQRLILERLQVMYTVGYSLSLATLLLALLILSLFRRLHCTRNYIHINLFTSF
MLRAAAILSRDRLLPRPGPYLGDQALALWNQALAACRTAQIVTQYCVGANYTWLLVEGVY
LHSLLVLVGGSEEGHFRYYLLLGWGAPALFVIPWVIVRYLYENTQCWERNEVKAIWWIIR
TPILMTILINFLIFIRILGILLSKLRTRQMRCRDYRLRLARSTLTLVPLLGVHEVVFAPV
TEEQARGALRFAKLGFEIFLSSFQGFLVSVLYCFINKEVQSEIRRGWHHCRLRRSLGEEQ
RQLPERAFRALPSGSGPGEVPTSRGLSSGTLPGPGNEASRELESYC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50360599
NameBDBM50360599
Synonyms:CHEMBL1933365
TypeSmall organic molecule
Emp. Form.C26H27F3N4O3
Mol. Mass.500.5128
SMILESOC(=O)CCNC(=O)c1ccc(cc1)C(Nc1cnn(c1)-c1ccc(cc1)C(F)(F)F)C1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a