Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase-like amidohydrolase
LigandBDBM50361261
Substrate/Competitorn/a
Meas. Tech.ChEMBL_795335
Kd 370±n/a nM
Citation Henkes, LMHaus, PJäger, FLudwig, JMeyer-Almes, FJ Synthesis and biochemical analysis of 2,2,3,3,4,4,5,5,6,6,7,7-dodecafluoro-N-hydroxy-octanediamides as inhibitors of human histone deacetylases. Bioorg Med Chem20:985-95 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase-like amidohydrolase
Name:Histone deacetylase-like amidohydrolase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:39419.78
Organism:Alcaligenes sp. (strain DSM 11172) (Bordetella sp. (strain FB188))
Description:ChEMBL_827139
Residue:369
Sequence:
MAIGYVWNTLYGWVDTGTGSLAAANLTARMQPISHHLAHPDTKRRFHELVCASGQIEHLT
PIAAVAATDADILRAHSAAHLENMKRVSNLPTGGDTGDGITMMGNGGLEIARLSAGGAVE
LTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWD
VHHGNGTQDIWWNDPSVLTISLHQHLCFPPDSGYSTERGAGNGHGYNINVPLPPGSGNAA
YLHAMDQVVLHALRAYRPQLIIVGSGFDASMLDPLARMMVTADGFRQMARRTIDCAADIC
DGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRSLPDPYHEFLAGMGGNTLLDAERAAIEE
IVPLLADIR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50361261
NameBDBM50361261
Synonyms:CHEMBL1934903
TypeSmall organic molecule
Emp. Form.C18H10F12N2O3
Mol. Mass.530.2644
SMILESONC(=O)C(F)(F)C(F)(F)C(F)(F)C(F)(F)C(F)(F)C(F)(F)C(=O)Nc1cccc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a