Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific histone demethylase 1B
LigandBDBM50346864
Substrate/Competitorn/a
Meas. Tech.ChEMBL_797218
Ki 38000±n/a nM
Citation Suzuki, TMiyata, N Lysine demethylases inhibitors. J Med Chem54:8236-50 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific histone demethylase 1B
Name:Lysine-specific histone demethylase 1B
Synonyms:Flavin-containing amine oxidase domain-containing protein 1 | Lysine-specific histone demethylase 2
Type:PROTEIN
Mol. Mass.:92112.91
Organism:Homo sapiens (Human)
Description:ChEMBL_992590
Residue:822
Sequence:
MATPRGRTKKKASFDHSPDSLPLRSSGRQAKKKATETTDEDEDGGSEKKYRKCEKAGCTA
TCPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTTWKKIWTSN
GKTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNTAIKPE
TSDHCSLPEDLRVLEVSNHWWYSMLILPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTNRA
AATGNASPGKLEHSKAALSVHVPGMNRYFQPFYQPNECGKALCVRPDVMELDELYEFPEY
SRDPTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKG
LINTGVLSVGADQYLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGR
VWDDKSFKGVTVGRGAQIVNGCINNPVALMCEQLGISMHKFGERCDLIQEGGRITDPTID
KRMDFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGIQFSELEGQVLQFHL
SNLEYACGSNLHQVSARSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIQLKSPVQC
IDYSGDEVQVTTTDGTGYSAQKVLVTVPLALLQKGAIQFNPPLSEKKMKAINSLGAGIIE
KIALQFPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVAS
VRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYD
IIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50346864
NameBDBM50346864
Synonyms:CHEMBL1797641 | CHEMBL3104337 | US8765820, 8
TypeSmall organic molecule
Emp. Form.C26H27N3O3
Mol. Mass.429.5109
SMILESNC1CC1c1ccc(NC(=O)C(Cc2ccccc2)NC(=O)OCc2ccccc2)cc1
Structure
n/a