Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 1A (PDE1A)
LigandBDBM50362035
Substrate/Competitorn/a
Meas. Tech.ChEMBL_797284
Ki>10000±n/a nM
Citation Yang, SWSmotryski, JMcElroy, WTTan, ZHo, GTulshian, DGreenlee, WJGuzzi, MZhang, XMullins, DXiao, LHruza, AChan, TMRindgen, DBleickardt, CHodgson, R Discovery of orally active pyrazoloquinolines as potent PDE10 inhibitors for the management of schizophrenia. Bioorg Med Chem Lett22:235-9 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 1A (PDE1A)
Name:Phosphodiesterase 1A (PDE1A)
Synonyms:Calmodulin-dependent phosphodiesterase | Phosphodiesterase 1 | Phosphodiesterase 1B (PDE1B)
Type:Protein
Mol. Mass.:61245.69
Organism:Homo sapiens (Human)
Description:P54750
Residue:535
Sequence:
MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGILRCLVKQLERGDVNVVDLKKNIEYAA
SVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRS
IVHAVQAGIFVERMYRKTYHMVGLAYPAAVIVTLKDVDKWSFDVFALNEASGEHSLKFMI
YELFTRYDLINRFKIPVSCLITFAEALEVGYSKYKNPYHNLIHAADVTQTVHYIMLHTGI
MHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLM
QEEEMNILINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSL
ILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF
IDFIVEPTFSLLTDSTEKIVIPLIEEASKAETSSYVASSSTTIVGLHIADALRRSNTKGS
MSDGSYSPDYSLAAVDLKSFKNNLVDIIQQNKERWKELAAQEARTSSQKCEFIHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50362035
NameBDBM50362035
Synonyms:CHEMBL1939914
TypeSmall organic molecule
Emp. Form.C18H22N4O2
Mol. Mass.326.3929
SMILESCOc1cc(C)c2nc3[nH]nc(C)c3c(CN3CCOCC3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a