Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCorticotropin releasing factor receptor 1
LigandBDBM50362272
Substrate/Competitorn/a
Meas. Tech.ChEMBL_798649
EC50 7.4±n/a nM
Citation Saito, TObitsu, TKohno, HSugimoto, IMatsushita, TNishiyama, THirota, TTakeda, HMatsumura, NUeno, SKishi, AKagamiishi, YNakai, HTakaoka, Y Pyrrolo[1,2-b]pyridazines, pyrrolo[2,1-f]triazin-4(3H)-ones, and related compounds as novel corticotropin-releasing factor 1 (CRF¿?) receptor antagonists. Bioorg Med Chem20:1122-38 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Corticotropin releasing factor receptor 1
Name:Corticotropin releasing factor receptor 1
Synonyms:CRF-R | CRF-R2 Alpha | CRF1 | CRH-R 1 | CRHR1 | Corticotropin-releasing factor receptor 1 (CRF-1) | Corticotropin-releasing factor receptor 1 (CRF1) | Corticotropin-releasing hormone receptor 1
Type:Enzyme
Mol. Mass.:50744.31
Organism:Homo sapiens (Human)
Description:P34998
Residue:444
Sequence:
MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRPGCTHWGDQADGALEVGAPWSGAPFQVRRSIRCLR
NIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGC
YLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYI
YQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFF
VNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARV
ARAMSIPTSPTRVSFHSIKQSTAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50362272
NameBDBM50362272
Synonyms:CHEMBL1939596
TypeSmall organic molecule
Emp. Form.C18H20ClN3O2
Mol. Mass.345.823
SMILESCOc1ccc(c(Cl)c1)-c1nn2c(C)cc(C(C)C)c2c(=O)n1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a