Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 9
LigandBDBM50363455
Substrate/Competitorn/a
Meas. Tech.ChEMBL_800185
IC50 10±n/a nM
Citation Krenitsky, VPDelgado, MNadolny, LSahasrabudhe, KAyala, LClareen, SSHilgraf, RAlbers, RKois, AHughes, KWright, JNowakowski, JSudbeck, EGhosh, SBahmanyar, SChamberlain, PMuir, JCathers, BEGiegel, DXu, LCeleridad, MMoghaddam, MKhatsenko, OOmholt, PKatz, JPai, SFan, RTang, YShirley, MABenish, BBlease, KRaymon, HBhagwat, SHenderson, ICole, AGBennett, BSatoh, Y Aminopurine based JNK inhibitors for the prevention of ischemia reperfusion injury. Bioorg Med Chem Lett22:1427-32 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 9
Name:Mitogen-activated protein kinase 9
Synonyms:JNK-55 | JNK2/JNK3 | Mitogen-Activated Protein Kinase 9 (JNK2) | Stress-activated protein kinase JNK2 | c-Jun N-terminal kinase 2 | c-Jun N-terminal kinase 2 (JNK2)
Type:Enzyme
Mol. Mass.:48131.49
Organism:Homo sapiens (human)
Description:JNK-2 was purchased from Upstate Cell Signaling Solutions (formerly Upstate Biotechnology).
Residue:424
Sequence:
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50363455
NameBDBM50363455
Synonyms:CHEMBL1946333
TypeSmall organic molecule
Emp. Form.C22H27FN6O
Mol. Mass.410.4878
SMILESO[C@H]1CC[C@@H](CC1)Nc1ncc2nc(Nc3ccccc3F)n(C3CCCC3)c2n1 |r,wU:1.0,wD:4.7,(-11.53,-21.51,;-10.75,-20.18,;-11.51,-18.84,;-10.74,-17.51,;-9.2,-17.52,;-8.43,-18.84,;-9.2,-20.18,;-8.44,-16.18,;-6.9,-16.18,;-6.13,-14.85,;-4.59,-14.85,;-3.83,-16.18,;-2.33,-16.49,;-2.17,-18.02,;-.84,-18.79,;.49,-18.03,;1.83,-18.8,;3.16,-18.02,;3.16,-16.47,;1.82,-15.71,;.5,-16.48,;-.84,-15.71,;-3.58,-18.65,;-3.58,-20.19,;-4.83,-21.09,;-4.36,-22.55,;-2.82,-22.56,;-2.34,-21.1,;-4.6,-17.51,;-6.13,-17.51,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a