Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTissue-type plasminogen activator
LigandBDBM50138662
Substrate/Competitorn/a
Meas. Tech.ChEMBL_801832
IC50>62000±n/a nM
Citation Venkatraj, MMessagie, JJoossens, JLambeir, AMHaemers, AVan der Veken, PAugustyns, K Synthesis and evaluation of non-basic inhibitors of urokinase-type plasminogen activator (uPA). Bioorg Med Chem20:1557-68 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tissue-type plasminogen activator
Name:Tissue-type plasminogen activator
Synonyms:Alteplase | Reteplase | Thrombin receptor protein | Tissue-type plasminogen activator | Tissue-type plasminogen activator (tPA) | Tissue-type plasminogen activator precursor | t-PA | t-Plasminogen Activator (tPA) | t-plasminogen activator
Type:Enzyme
Mol. Mass.:62931.08
Organism:Homo sapiens (Human)
Description:n/a
Residue:562
Sequence:
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWN
SMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQK
DVPGVYTKVTNYLDWIRDNMRP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50138662
NameBDBM50138662
Synonyms:6-Carbamimidoyl-naphthalene-2-carboxylic acid (4-aminomethyl-phenyl)-amide | 6-[(Z)-AMINO(IMINO)METHYL]-N-[4-(AMINOMETHYL)PHENYL]-2-NAPHTHAMIDE | CHEMBL324168 | N-(4-(aminomethyl)phenyl)-6-carbamimidoyl-2-naphthamide | uPa_9
TypeSmall organic molecule
Emp. Form.C19H18N4O
Mol. Mass.318.3724
SMILESNCc1ccc(NC(=O)c2ccc3cc(ccc3c2)C(N)=N)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a