Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAstrosclerin-3
LigandBDBM50010231
Substrate/Competitorn/a
Meas. Tech.ChEMBL_804821
Ki 450000±n/a nM
Citation Ohradanova, AVullo, DPastorekova, SPastorek, JJackson, DJWörheide, GSupuran, CT Anion inhibition studies of ana-carbonic anhydrase from the living fossil Astrosclera willeyana. Bioorg Med Chem Lett22:1314-6 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Astrosclerin-3
Name:Astrosclerin-3
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:33233.07
Organism:Astrosclera willeyana
Description:ChEMBL_801827
Residue:292
Sequence:
MMAYKVLHFVVISLGLVTLVASRCDFNYYNQRAWLSCPGSQCGGNRQSPINIDTEKTKAN
NSLIALRFNDYDDPVDGDFENLGTTVEFVPETKDATLTNHLGTYDLLQFHFHWGRDSSEG
SEHRIDDEQYSAEIHFVHLKQGASPSDTAGDTFSVVAVLCEAADIPIRGVWAKLSPVPTG
HEDSHSVSDLVYTDLLPRNRDYYHYEGSLTTPLCDETVQWFVLKNTIKIPKAFLTMLRRV
ESDEDGTLLTFNFRNLQRLNGRQVFEFPPDVDNGEDKKRKRRNNRHGRDHHG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010231
NameBDBM50010231
Synonyms:CHEMBL107217 | Ditiocarb sodium | Sodium salt of Diethyl-dithiocarbamic acid(DDC) | US9180183, DDTC | sodium N,N-diethyl-dithiocarbamate | sodium diethyldithiocarbamate
TypeSmall organic molecule
Emp. Form.C5H10NS2
Mol. Mass.148.27
SMILESCCN(CC)C([S-])=S
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a