BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-L-fucosidase 2
LigandBDBM50065258
Substrate/Competitorn/a
Meas. Tech.ChEBML_34091
Ki 9.8±n/a nM
Citation Andrews, DBird, MCunningham, MWard, P Synthesis of and glycosidase inhibition by -l-homofuconojirimycin Bioorg Med Chem Lett3:2533-2536 (1993)    Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-L-fucosidase 2
Name:Alpha-L-fucosidase 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:54063.48
Organism:Homo sapiens (Human)
Description:ChEMBL_34091
Residue:467
Sequence:
MRPQELPRLAFPLLLLLLLLLPPPPCPAHSATRFDPTWESLDARQLPAWFDQAKFGIFIH
WGVFSVPSFGSEWFWWYWQKEKIPKYVEFMKDNYPPSFKYEDFGPLFTAKFFNANQWADI
FQASGAKYIVLTSKHHEGFTLWGSEYSWNWNAIDEGPKRDIVKELEVAIRNRTDLRFGLY
YSLFEWFHPLFLEDESSSFHKRQFPVSKTLPELYELVNNYQPEVLWSDGDGGAPDQYWNS
TGFLAWLYNESPVRGTVVTNDRWGAGSICKHGGFYTCSDRYNPGHLLPHKWENCMTIDKL
SWGYRREAGISDYLTIEELVKQLVETVSCGGNLLMNIGPTLDGTISVVFEERLRQMGSWL
KVNGEAIYETHTWRSQNDTVTPDVWYTSKPKEKLVYAIFLKWPTSGQLFLGHPKAILGAT
EVKLLGHGQPLNWISLEQNGIMVELPQLTIHQMPCKWGWALALTNVI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50065258
NameBDBM50065258
Synonyms:(2S,3R,4S,5R)-2-Methyl-piperidine-3,4,5-triol | (2S,3R,4S,5R)-2-methylpiperidine-3,4,5-triol | CHEMBL314772 | Fucosidase Inhibitor, 3
TypeSmall organic molecule
Emp. Form.C6H13NO3
Mol. Mass.147.1723
SMILESC[C@@H]1NC[C@@H](O)[C@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a