BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid X receptor gamma/retinoic acid receptor alpha
LigandBDBM50048280
Substrate/Competitorn/a
Meas. Tech.ChEBML_197414
Ki 1100±n/a nM
Citation Diaz, PMichel, SStella, LCharpentier, B Synthesis and biological activities of new heterocyclic aromatic retinoids Bioorg Med Chem Lett7:2289-2294 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid X receptor gamma/retinoic acid receptor alpha
Name:Retinoic acid receptor alpha/Retinoid X receptor alpha
Synonyms:Nuclear receptor subfamily 1 group B member 1 | RAR-alpha | Retinoic acid receptor alpha
Type:PROTEIN
Mol. Mass.:50778.87
Organism:Homo sapiens (Human)
Description:ChEMBL_1466191
Residue:462
Sequence:
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50048280
NameBDBM50048280
Synonyms:6-(3-(1-Adamantyl)-4-methoxyphenyl)-2-naphthoic acid | 6-(3-adamantan-1-yl-4-methoxyphenyl)naphthalene-2-carboxylic acid | ADAPALENE | CHEMBL1265
TypeSmall organic molecule
Emp. Form.C28H28O3
Mol. Mass.412.5201
SMILESCOc1ccc(cc1C12CC3CC(CC(C3)C1)C2)-c1ccc2cc(ccc2c1)C(O)=O |TLB:7:8:11:15.14.13,THB:9:10:13:17.8.16,9:8:11.10.15:13,16:8:11:15.14.13,16:14:11:17.9.8|
Structure
n/a