Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetArginyl-tRNA synthetase
LigandBDBM50091515
Substrate/Competitorn/a
Meas. Tech.ChEBML_36050
IC50 4.5±n/a nM
Citation Forrest, AKJarvest, RLMensah, LMO'Hanlon, PJPope, AJSheppard, RJ Aminoalkyl adenylate and aminoacyl sulfamate intermediate analogues differing greatly in affinity for their cognate Staphylococcus aureus aminoacyl tRNA synthetases. Bioorg Med Chem Lett10:1871-4 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Arginyl-tRNA synthetase
Name:Arginyl-tRNA synthetase
Synonyms:ArgRS | Arginine--tRNA ligase | Arginyl-tRNA synthetase, cytoplasmic
Type:PROTEIN
Mol. Mass.:75379.14
Organism:Homo sapiens (Human)
Description:ChEMBL_36050
Residue:660
Sequence:
MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRK
SLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMG
ISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLV
NGVQLPALGENKKVIVDFSSPNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGD
WGTQFGMLIAHLQDKFPDYLTVSPPIGDLQVFYKESKKRFDTEEEFKKRAYQCVVLLQGK
NPDITKAWKLICDVSRQELNKIYDALDVSLIERGESFYQDRMNDIVKEFEDRGFVQVDDG
RKIVFVPGCSIPLTIVKSDGGYTYDTSDLAAIKQRLFEEKADMIIYVVDNGQSVHFQTIF
AAAQMIGWYDPKVTRVFHAGFGVVLGEDKKKFKTRSGETVRLMDLLGEGLKRSMDKLKEK
ERDKVLTAEELNAAQTSVAYGCIKYADLSHNRLNDYIFSFDKMLDDRGNTAAYLLYAFTR
IRSIARLANIDEEMLQKAARETKILLDHEKEWKLGRCILRFPEILQKILDDLFLHTLCDY
IYELATAFTEFYDSCYCVEKDRQTGKILKVNMWRMLLCEAVAAVMAKGFDILGIKPVQRM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50091515
NameBDBM50091515
Synonyms:Aminoalkyl adenylate and aminoacyl sulfamate analogue
TypeSmall organic molecule
Emp. Form.C16H27N10O7S
Mol. Mass.503.513
SMILESN[C@@H](CCCNC(N)=[NH2+])C(=O)NS(=O)(=O)OC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a