Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetType 1 dehydroquinase
LigandBDBM50086505
Substrate/Competitorn/a
Meas. Tech.ChEBML_213101
Ki 80000±n/a nM
Citation Bello, CGHarris, JMManthey, MKCoggins, JRAbell, C Irreversible inhibition of type I dehydroquinase by substrates for type II dehydroquinase. Bioorg Med Chem Lett10:407-9 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Type 1 dehydroquinase
Name:Type 1 dehydroquinase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:27460.29
Organism:Escherichia coli (strain K12)
Description:ChEMBL_213101
Residue:252
Sequence:
MKTVTVKDLVIGTGAPKIIVSLMAKDIASVKSEALAYREADFDILEWRVDHYADLSNVES
VMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTG
DDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSD
VLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVN
DLRTVLTILHQA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50086505
NameBDBM50086505
Synonyms:2-Fluoro-1,4,5-trihydroxy-3-oxo-cyclohexanecarboxylic acid anion
TypeSmall organic molecule
Emp. Form.C7H8FO6
Mol. Mass.207.1338
SMILESOC1CC(O)(C(F)C(=O)C1O)C([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a