Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 6 (mGlu6)
LigandBDBM50102125
Substrate/Competitorn/a
Meas. Tech.ChEMBL_104460
EC50 100000±n/a nM
Citation Mukhopadhyaya, JKKozikowski, APGrajkowska, EPshenichkin, SWroblewski, JT Synthesis of N(1)-substituted analogues of (2R,4R)-4-amino-pyrrolidine-2,4-dicarboxylic acid as agonists, partial agonists, and antagonists of group II metabotropic glutamate receptors. Bioorg Med Chem Lett11:1919-24 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Metabotropic glutamate receptor 6 (mGlu6)
Name:Metabotropic glutamate receptor 6 (mGlu6)
Synonyms:GRM6 | mGlu6 | mGluR6 | metabotropic glutamate 6
Type:Enzyme
Mol. Mass.:95095.82
Organism:Rattus norvegicus (Rat)
Description:P35349
Residue:871
Sequence:
MGRLPVLLLWLAWWLSQAGIACGAGSVRLAGGLTLGGLFPVHARGAAGRACGALKKEQGV
HRLEAMLYALDRVNADPELLPGVRLGARLLDTCSRDTYALEQALSFVQALIRGRGDGDEA
SVRCPGGVPPLRSAPPERVVAVVGASASSVSIMVANVLRLFAIPQISYASTAPELSDSTR
YDFFSRVVPPDSYQAQAMVDIVRALGWNYVSTLASEGNYGESGVEAFVQISREAGGVCIA
QSIKIPREPKPGEFHKVIRRLMETPNARGIIIFANEDDIRRVLEATRQANLTGHFLWVGS
DSWGSKISPILNLEEEAVGAITILPKRASIDGFDQYFMTRSLENNRRNIWFAEFWEENFN
CKLTSSGGQSDDSTRKCTGEERIGQDSAYEQEGKVQFVIDAVYAIAHALHSMHQALCPGH
TGLCPAMEPTDGRTLLHYIRAVRFNGSAGTPVMFNENGDAPGRYDIFQYQATNGSASSGG
YQAVGQWAEALRLDMEVLRWSGDPHEVPPSQCSLPCGPGERKKMVKGVPCCWHCEACDGY
RFQVDEFTCEACPGDMRPTPNHTGCRPTPVVRLTWSSPWAALPLLLAVLGIMATTTIMAT
FMRHNDTPIVRASGRELSYVLLTGIFLIYAITFLMVAEPCAAICAARRLLLGLGTTLSYS
ALLTKTNRIYRIFEQGKRSVTPPPFISPTSQLVITFGLTSLQVVGVIAWLGAQPPHSVID
YEEQRTVDPEQARGVLKCDMSDLSLIGCLGYSLLLMVTCTVYAIKARGVPETFNEAKPIG
FTMYTTCIIWLAFVPIFFGTAQSAEKIYIQTTTLTVSLSLSASVSLGMLYVPKTYVILFH
PEQNVQKRKRSLKKTSTMAAPPQNENAEDAK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50102125
NameBDBM50102125
Synonyms:(2R,4R)-4-amino-1-(3-nitrobenzyl)pyrrolidine-2,4-dicarboxylic acid dihydrochloride | CHEMBL539760
TypeSmall organic molecule
Emp. Form.C13H15N3O6
Mol. Mass.309.2747
SMILESN[C@@]1(C[C@@H](N(Cc2cccc(c2)[N+]([O-])=O)C1)C(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a