Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-glucosidase A
LigandBDBM50104304
Substrate/Competitorn/a
Meas. Tech.ChEMBL_37437
IC50 340000±n/a nM
Citation Popowycz, FGerber-Lemaire, SDemange, RRodriguez-García, EAsenjo, ATRobina, IVogel, P Derivatives of (2R,3R,4S)-2-aminomethylpyrrolidine-3,4-diol are selective alpha-mannosidase inhibitors. Bioorg Med Chem Lett11:2489-93 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-glucosidase A
Name:Beta-glucosidase A
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:53484.21
Organism:Caldocellum saccharolyticum
Description:ChEMBL_37437
Residue:455
Sequence:
MDMSFPKGFLWGAATASYQIEGAWNEDGKGESIWDRFTHQKRNILYGHNGDVACDHYHRF
EEDVSLMKELGLKAYRFSIAWTRIFPDGFGTVNQKGLEFYDRLINKLVENGIEPVVTLYH
WDLPQKLQDIGGWANPEIVNYYFDYAMLVINRYKDKVKKWITFNEPYCIAFLGYFHGIHA
PGIKDFKVAMDVVHSLMLSHFKVVKAVKENNIDVEVGITLNLTPVYLQTERLGYKVSEIE
REMVSLSSQLDNQLFLDPVLKGSYPQKLLDYLVQKDLLDSQKALSMQQEVKENFIFPDFL
GINYYTRAVRLYDENSSWIFPIRWEHPAGEYTEMGWEVFPQGLFDLLIWIKESYPQIPIY
ITENGAAYNDIVTEDGKVHDSKRIEYLKQHFEAARKAIENGVDLRGYFVWSLMDNFEWAM
GYTKRFGIIYVDYETQKRIKKDSFYFYQQYIKENS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50104304
NameBDBM50104304
Synonyms:2-[((S)-1-Hydroxy-ethylamino)-methyl]-pyrrolidine-3,4-diol | BDBM50402988 | CHEMBL2206826 | CHEMBL312569
TypeSmall organic molecule
Emp. Form.C7H16N2O3
Mol. Mass.176.2135
SMILESC[C@@H](O)NC[C@H]1NC[C@H](O)[C@@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a