Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSteryl-sulfatase
LigandBDBM50097933
Substrate/Competitorn/a
Meas. Tech.ChEBML_68020
IC50 263000±n/a nM
Citation Ahmed, SJames, KOwen, CPPatel, CKPatel, M Hydrophobicity, a physicochemical factor in the inhibition of the enzyme estrone sulfatase (ES). Bioorg Med Chem Lett11:2525-8 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Steryl-sulfatase
Name:Steryl-sulfatase
Synonyms:ASC | Arylsulfatase C | Steroid sulfatase | Steryl-sulfate sulfohydrolase
Type:Enzyme
Mol. Mass.:65503.66
Organism:Homo sapiens (human)
Description:P08842
Residue:583
Sequence:
MPLRKMKIPFLLLFFLWEAESHAASRPNIILVMADDLGIGDPGCYGNKTIRTPNIDRLAS
GGVKLTQHLAASPLCTPSRAAFMTGRYPVRSGMASWSRTGVFLFTASSGGLPTDEITFAK
LLKDQGYSTALIGKWHLGMSCHSKTDFCHHPLHHGFNYFYGISLTNLRDCKPGEGSVFTT
GFKRLVFLPLQIVGVTLLTLAALNCLGLLHVPLGVFFSLLFLAALILTLFLGFLHYFRPL
NCFMMRNYEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFA
GKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGS
NGIYKGGKANNWEGGIRVPGILRWPRVIQAGQKIDEPTSNMDIFPTVAKLAGAPLPEDRI
IDGRDLMPLLEGKSQRSDHEFLFHYCNAYLNAVRWHPQNSTSIWKAFFFTPNFNPVGSNG
CFATHVCFCFGSYVTHHDPPLLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQT
LPEVPDQFSWNNFLWKPWLQLCCPSTGLSCQCDREKQDKRLSR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50097933
NameBDBM50097933
Synonyms:CHEMBL85468 | Sulfamic acid 4-[(E)-(3-phenyl-acryloyl)]-phenyl ester
TypeSmall organic molecule
Emp. Form.C15H13NO4S
Mol. Mass.303.333
SMILESNS(=O)(=O)Oc1ccc(cc1)C(=O)\C=C\c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a