Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSubstance-K receptor
LigandBDBM50279775
Substrate/Competitorn/a
Meas. Tech.ChEBML_209035
Ki 0.600000±n/a nM
Citation Bernstein, PRAharony, DAlbert, JSAndisik, DBarthlow, HGBialecki, RDavenport, TDedinas, RFDembofsky, BTKoether, GKosmider, BJKirkland, KOhnmacht, CJPotts, WRumsey, WLShen, LShenvi, ASherwood, SStollman, DRussell, K Discovery of novel, orally active dual NK1/NK2 antagonists. Bioorg Med Chem Lett11:2769-73 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Substance-K receptor
Name:Neurokinin 2 receptor
Synonyms:NK-2 receptor | NK-2R | Neurokinin 2 receptor | Neurokinin A receptor | Neurokinin NK2 | Neurokinin-2 (NK-2) | Neuromedin-2 receptor (NK-2R) | SKR | Tachykinin receptor 2 | Tachykinin receptor 2 (NK2)
Type:Protein
Mol. Mass.:44455.78
Organism:Homo sapiens (Human)
Description:P21452
Residue:398
Sequence:
MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA
HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK
CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR
HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA
GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50279775
NameBDBM50279775
Synonyms:(S)-3-Cyano-naphthalene-1-carboxylic acid {2-(3,4-dichloro-phenyl)-4-[4-(2-methanesulfinyl-phenyl)-piperidin-1-yl]-butyl}-methyl-amide | 3-Cyano-naphthalene-1-carboxylic acid ((S)-2-(3,4-dichloro-phenyl)-4-{4-[2-((S)-methanesulfinyl)-phenyl]-piperidin-1-yl}-butyl)-methyl-amide | CHEMBL129683
TypeSmall organic molecule
Emp. Form.C35H35Cl2N3O2S
Mol. Mass.632.642
SMILESCN(C[C@@H](CCN1CCC(CC1)c1ccccc1[S@](C)=O)c1ccc(Cl)c(Cl)c1)C(=O)c1cc(cc2ccccc12)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a