Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMandelate racemase (MR)
LigandBDBM50080274
Substrate/Competitorn/a
Meas. Tech.ChEBML_105194
pH7.5±n/a
Ki 3600000±n/a nM
Commentsextracted
Citation St Maurice, MBearne, SLLu, WTaylor, SD Inhibition of mandelate racemase by alpha-fluorobenzylphosphonates. Bioorg Med Chem Lett13:2041-4 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mandelate racemase (MR)
Name:Mandelate racemase
Synonyms:Mandelate racemase
Type:Protein
Mol. Mass.:38561.77
Organism:Pseudomonas putida (g-Proteobacteria)
Description:n/a
Residue:359
Sequence:
MSEVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALK
SLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFCLAGYTGLIRMAAAGIDMAAWDALGKVHE
TPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTKIGYPALDQDLAVVR
SIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLN
VPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGGVTGWIRASALAQQFGIPMSSHLFQ
EISAHLLAATPTAHWLERLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYLV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50080274
NameBDBM50080274
Synonyms:Benzyl-phosphonic acid | CHEMBL299737 | Phenyl-methanephosphonic acid anion | benzylphosphonic acid
TypeSmall organic molecule
Emp. Form.C7H9O3P
Mol. Mass.172.1183
SMILESOP(O)(=O)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a