Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMandelate racemase (MR)
LigandBDBM16420
Substrate/Competitorn/a
Meas. Tech.ChEBML_105194
pH7.5±n/a
Ki 570000±n/a nM
Commentsextracted
Citation St Maurice, MBearne, SLLu, WTaylor, SD Inhibition of mandelate racemase by alpha-fluorobenzylphosphonates. Bioorg Med Chem Lett13:2041-4 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mandelate racemase (MR)
Name:Mandelate racemase
Synonyms:Mandelate racemase
Type:Protein
Mol. Mass.:38561.77
Organism:Pseudomonas putida (g-Proteobacteria)
Description:n/a
Residue:359
Sequence:
MSEVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALK
SLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFCLAGYTGLIRMAAAGIDMAAWDALGKVHE
TPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTKIGYPALDQDLAVVR
SIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLN
VPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGGVTGWIRASALAQQFGIPMSSHLFQ
EISAHLLAATPTAHWLERLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYLV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16420
NameBDBM16420
Synonyms:(2S)-2-hydroxy-2-phenylacetic acid | CHEMBL58910 | L-Mandelic acid | S-(+)-Mandelic acid | cid_1292 | cid_439616
TypeSmall organic molecule
Emp. Form.C8H8O3
Mol. Mass.152.1473
SMILESO[C@H](C(O)=O)c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a