Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMandelate racemase (MR)
LigandBDBM50102186
Substrate/Competitorn/a
Meas. Tech.ChEBML_105194
pH7.5±n/a
Ki 12000000±n/a nM
Commentsextracted
Citation St Maurice, MBearne, SLLu, WTaylor, SD Inhibition of mandelate racemase by alpha-fluorobenzylphosphonates. Bioorg Med Chem Lett13:2041-4 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mandelate racemase (MR)
Name:Mandelate racemase
Synonyms:Mandelate racemase
Type:Protein
Mol. Mass.:38561.77
Organism:Pseudomonas putida (g-Proteobacteria)
Description:n/a
Residue:359
Sequence:
MSEVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALK
SLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFCLAGYTGLIRMAAAGIDMAAWDALGKVHE
TPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTKIGYPALDQDLAVVR
SIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLN
VPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGGVTGWIRASALAQQFGIPMSSHLFQ
EISAHLLAATPTAHWLERLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYLV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50102186
NameBDBM50102186
Synonyms:(Difluoro-phenyl-methyl)-phosphonic acid | CHEMBL57974 | Difluoro-phenyl-methanephosphonic acid anion
TypeSmall organic molecule
Emp. Form.C7H7F2O3P
Mol. Mass.208.0992
SMILESOP(O)(=O)C(F)(F)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a