Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitochondrial complex I; NADH oxidoreductase
LigandBDBM50130143
Substrate/Competitorn/a
Meas. Tech.ChEMBL_141733
IC50 4500±n/a nM
Citation Yabunaka, HAbe, MKenmochi, AHamada, TNishioka, TMiyoshi, H Synthesis and inhibitory activity of ubiquinone-acetogenin hybrid inhibitor with bovine mitochondrial complex I. Bioorg Med Chem Lett13:2385-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitochondrial complex I; NADH oxidoreductase
Name:Mitochondrial complex I; NADH oxidoreductase
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 141738
Components:This complex has 2 components.
Component 1
Name:NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
Synonyms:CI-51kD | Complex I-51kD | NADH dehydrogenase flavoprotein 1 | NADH-ubiquinone oxidoreductase 51 kDa subunit | NDUFV1 | UQOR1
Type:PROTEIN
Mol. Mass.:50659.85
Organism:Bos taurus
Description:EBI_100771
Residue:464
Sequence:
MLAARRLLGGSLPARVSVRFSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRG
DWYKTKEILLKGPDWILGEVKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG
EPGTCKDREIIRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG
LIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT
TVANVETVAVSPTICRRGGAWFASFGRERNSGTKLFNISGHVNNPCTVEEEMSVPLKELI
EKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALIQAQTGLGTAAVIVMDRS
TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIE
GHTICALGDGAAWPVQGLIRHFRPELEERMQQFAQQHQARQAAF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Acyl carrier protein, mitochondrial
Synonyms:ACP | CI-SDAP | NADH-ubiquinone oxidoreductase 9.6 kDa subunit | NDUFAB1
Type:PROTEIN
Mol. Mass.:17397.64
Organism:Bos taurus
Description:ChEMBL_469770
Residue:156
Sequence:
MAVRVLCACVRRLPTAFAPLPRLPTLAAARPLSTTLFAAETRTRPGAPLPALVLAQVPGR
VTQLCRQYSDAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIM
AMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50130143
NameBDBM50130143
Synonyms:(R)-1-[(2R,5R,2'R,5'R)-5'-((R)-1-hydroxy-hexyl)-octahydro-[2,2']bifuranyl-5-yl]-hexan-1-ol | (R)-1-[(2R,5R,4'R)-5'-((1R,2R)-1-Hydroxy-hexyl)-octahydro-[2,2']bifuranyl-5-yl]-hexan-1-ol | CHEMBL80354
TypeSmall organic molecule
Emp. Form.C20H38O4
Mol. Mass.342.5133
SMILESCCCCC[C@@H](O)[C@H]1CC[C@@H](O1)[C@H]1CC[C@@H](O1)[C@H](O)CCCCC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a