Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 3 (MC3R)
LigandBDBM50131251
Substrate/Competitorn/a
Meas. Tech.ChEBML_79558
Ki 14±n/a nM
Citation Koikov, LNEbetino, FHSolinsky, MGCross-Doersen, DKnittel, JJ Sub-nanomolar hMC1R agonists by end-capping of the melanocortin tetrapeptide His-D-Phe-Arg-Trp-NH(2). Bioorg Med Chem Lett13:2647-50 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 3 (MC3R)
Name:Melanocortin receptor (M3 and M4)
Synonyms:MC3-R | MC3R | Melanocortin MC3 | Melanocortin receptor (M3 and M4) | Melanocortin receptor 3
Type:Enzyme
Mol. Mass.:36044.86
Organism:Homo sapiens (Human)
Description:P41968
Residue:323
Sequence:
MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVI
LAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIF
DSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFI
VYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFREILCGCNGMNLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50131251
NameBDBM50131251
Synonyms:(S)-5-Guanidino-2-{(S)-2-[(S)-3-(3H-imidazol-4-yl)-2-(4-phenyl-butyrylamino)-propionylamino]-3-phenyl-propionylamino}-pentanoic acid [(S)-1-carbamoyl-2-(1H-indol-3-yl)-ethyl]-amide | CHEMBL431801
TypeSmall organic molecule
Emp. Form.C42H51N11O5
Mol. Mass.789.925
SMILESNC(=N)NCCC[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)CCCc1ccccc1)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a