Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSteroid 5-alpha-reductase
LigandBDBM50025375
Substrate/Competitorn/a
Meas. Tech.ChEMBL_204598
IC50 3.4±n/a nM
Citation Rasmusson, GHReynolds, GFSteinberg, NGWalton, EPatel, GFLiang, TCascieri, MACheung, AHBrooks, JRBerman, C Azasteroids: structure-activity relationships for inhibition of 5 alpha-reductase and of androgen receptor binding. J Med Chem29:2298-315 (1986) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Steroid 5-alpha-reductase
Name:Steroid 5-alpha-reductase
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 204723
Components:This complex has 2 components.
Component 1
Name:Steroid 5-alpha-reductase
Synonyms:Steroid 5-alpha-reductase 1
Type:PROTEIN
Mol. Mass.:29788.29
Organism:Rattus norvegicus
Description:ChEMBL_1441437
Residue:259
Sequence:
MVPLMELDELCLLDMLVYLEGFMAFVSIVGLRSVGSPYGRYSPQWPGIRVPARPAWFIQE
LPSMAWPLYEYIRPAAARLGNLPNRVLLAMFLIHYVQRTLVFPVLIRGGKPTLLVTFVLA
FLFCTFNGYVQSRYLSQFAVYAEDWVTHPCFLTGFALWLVGMVINIHSDHILRNLRKPGE
TGYKIPRGGLFEYVSAANYFGELVEWCGFALASWSLQGVVFALFTLSTLLTRAKQHHQWY
HEKFEDYPKSRKILIPFVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Steroid 5-alpha-reductase
Synonyms:Steroid 5-alpha-reductase 2
Type:PROTEIN
Mol. Mass.:28784.15
Organism:Rattus norvegicus
Description:ChEMBL_205054
Residue:254
Sequence:
MQIVCHQVPVLAGSATLATMGTLILCLGKPASYGKHTESVSSGVPFLPARIAWFLQELPS
FVVSVGMLAWQPRSLFGPPGNVLLALFSAHYFHRTFIYSLLTRGRPFPAVLFLRATAFCI
GNGLLQAYYLVYCAEYPEEWYTDVRFSFGVFLFILGMGINIHSDYTLRQLRKPGEVIYRI
PRGGLFTYVSGANFLGEIIEWIGYALATWSVPAFAFAFFTLCFLGMQAFYHHRFYLKMFK
DYPKSRKALIPFIF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50025375
NameBDBM50025375
Synonyms:7-Acetyl-1,4a,6a,8-tetramethyl-hexadecahydro-indeno[5,4-f]quinolin-2-one | CHEMBL3349082 | CHEMBL76759
TypeSmall organic molecule
Emp. Form.C22H35NO2
Mol. Mass.345.5188
SMILES[H][C@@]12C[C@@H](C)[C@H](C(C)=O)[C@@]1(C)CC[C@@]1([H])[C@@]2([H])CCC2N(C)C(=O)CC[C@]12C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a