Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H1 receptor
LigandBDBM50019631
Substrate/Competitorn/a
Meas. Tech.ChEBML_75330
IC50 16±n/a nM
Citation Iemura, RKawashima, TFukuda, TIto, KTsukamoto, G Synthesis of 2-(4-substituted-1-piperazinyl)benzimidazoles as H1-antihistaminic agents. J Med Chem29:1178-83 (1987) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H1 receptor
Name:Histamine H1 receptor
Synonyms:HISTAMINE H1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:55641.53
Organism:Cavia porcellus (domestic guinea pig)
Description:Guinea pig cerebellum was used in binding assay.
Residue:488
Sequence:
MSFLPGMTPVTLSNFSWALEDRMLEGNSTTTPTRQLMPLVVVLSSVSLVTVALNLLVLYA
VRSERKLHTVGNLYIVSLSVADLIVGAVVMPMSILYLHRSAWILGRPLCLFWLSMDYVAS
TASIFSVFILCIDRYRSVQQPLRYLRYRTKTRASATILGAWLLSFLWVIPILGWHHFMAP
TSEPREKKCETDFYDVTWFKVMTAIINFYLPTLLMLWFYIRIYKAVRRHCQHRQLINSSL
PSFSEMKLKLENAKVDTRRMGKESPWEDPKRCSKDASGVHTPMPSSQHLVDMPCAAVLSE
DEGGEVGTRQMPMLAVGDGRCCEALNHMHSQLELSGQSRATHSISARPEEWTVVDGQSFP
ITDSDTSTEAAPMGGQPRSGSNSGLDYIKFTWRRLRSHSRQYTSGLHLNRERKAAKQLGC
IMAAFILCWIPYFVFFMVIAFCKSCSNEPVHMFTIWLGYLNSTLNPLIYPLCNENFRKTF
KRILRIPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50019631
NameBDBM50019631
Synonyms:1-(2-Ethoxy-ethyl)-2-(4-propyl-piperazin-1-yl)-1H-benzoimidazole | CHEMBL18151
TypeSmall organic molecule
Emp. Form.C18H28N4O
Mol. Mass.316.4411
SMILESCCCN1CCN(CC1)c1nc2ccccc2n1CCOCC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a