Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor
LigandBDBM50016459
Substrate/Competitorn/a
Meas. Tech.ChEMBL_145159
Ki 22±n/a nM
Citation Portoghese, PSLarson, DLRonsisvalle, GSchiller, PWNguyen, TMLemieux, CTakemori, AE Hybrid bivalent ligands with opiate and enkephalin pharmacophores. J Med Chem30:1991-4 (1987) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mu-type opioid receptor
Name:Mu-type opioid receptor
Synonyms:M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50016459
NameBDBM50016459
Synonyms:2-[2-(2-{2-[2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-4-carbamoyl-butyrylamino}-acetylamino)-3-phenyl-propionylamino]-4-methyl-pentanoic acid | CHEMBL294134
TypeSmall organic molecule
Emp. Form.C31H42N6O8
Mol. Mass.626.7006
SMILESCC(C)C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a