Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNorepinephrine Monoamine transporters
LigandBDBM50367657
Substrate/Competitorn/a
Meas. Tech.ChEMBL_140759
IC50 17±n/a nM
Citation Bøgesø, KPArnt, JBoeck, VChristensen, AVHyttel, JJensen, KG Antihypertensive activity in a series of 1-piperazino-3-phenylindans with potent 5-HT2-antagonistic activity. J Med Chem31:2247-56 (1989) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Norepinephrine Monoamine transporters
Name:Monoamine transporters; Norepininephrine & dopamine
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:66787.87
Organism:Rattus norvegicus
Description:ChEMBL_1463061
Residue:597
Sequence:
MVTRTRETWGKKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLF
YMELALGQFNREGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFASFTLN
LPWTNCGHAWNSPNCTDPKLLNASVLGDHTKYSKYKFTPAAEFYERGVLHLHESSGIHDI
GLPQWQLLLCLMVVIVVLYVSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNG
INAYLHIDFYRLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSTIN
CVTSFISGFAIFSILGYMAHEHKVKIEDVATEGAGLVFVLYPEAISTLSGSTFWAVLFFL
MLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLFTCAVTLGTFLLAMFCITKGGIYVLT
LLDTFAAGTSILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFKPGLYWRLCWKFVSPAFLL
FVVVVSIINFKPLTYDDYVYPPWANWVGWGIALSSMILVPAYVIYKFFSIRGSLWERVAY
GITPENEHHLLALEIELSSLQSFVITSCPIDPLLSSFLFISCQKTLVFKKSGPAPLI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50367657
NameBDBM50367657
Synonyms:CHEMBL1237328
TypeSmall organic molecule
Emp. Form.C24H28F2N4O
Mol. Mass.426.5021
SMILESFc1ccc(cc1)[C@H]1C[C@H](N2CCN(CCN3CCNC3=O)CC2)c2cc(F)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a