Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50011320
Substrate/Competitorn/a
Meas. Tech.ChEBML_54443
IC50 52±n/a nM
Citation Rosowsky, ABader, HCucchi, CAMoran, RGKohler, WFreisheim, JH Methotrexate analogues. 33. N delta-acyl-N alpha-(4-amino-4-deoxypteroyl)-L-ornithine derivatives: synthesis and in vitro antitumor activity. J Med Chem31:1332-7 (1988) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase
Synonyms:n/a
Type:Enzyme
Mol. Mass.:21608.82
Organism:Mus musculus (Mouse)
Description:n/a
Residue:187
Sequence:
MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50011320
NameBDBM50011320
Synonyms:CHEMBL18155 | N-(4-Carboxy-4-{4-[(2,4-diamino-pteridin-6-ylmethyl)-amino]-benzoylamino}-butyl)-phthalamic acid | N-(4-Carboxy-4-{4-[(2,4-diamino-pteridin-6-ylmethyl)-amino]-benzoylamino}-butyl)-phthalamic acid(PT523)
TypeSmall organic molecule
Emp. Form.C27H27N9O6
Mol. Mass.573.56
SMILESNc1nc(N)c2nc(CNc3ccc(cc3)C(=O)NC(CCCNC(=O)c3ccccc3C(O)=O)C(O)=O)cnc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a