Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2b
LigandBDBM50014154
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32912
Ki>1000±n/a nM
Citation Rosen, TNagel, AARizzi, JPIves, JLDaffeh, JBGanong, AHGuarino, KHeym, JMcLean, SNowakowski, JT Thiazole as a carbonyl bioisostere. A novel class of highly potent and selective 5-HT3 receptor antagonists. J Med Chem33:2715-20 (1990) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2b
Name:Adenosine receptor A2b
Synonyms:Adora2b
Type:PROTEIN
Mol. Mass.:36378.84
Organism:Rattus norvegicus
Description:ChEMBL_32934
Residue:332
Sequence:
MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA
IPFAITISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT
RARGIIAVLWVLAFGIGLTPFLGWNSKDRATSNCTEPGDGITNKSCCPVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMMVIYIKIFMVACKQLQHMELMEHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYS
FHRIISRYVLCQTDTKGGSGQAGGQSTFSLSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50014154
n/a
NameBDBM50014154
Synonyms:2-(5-Methyl-1H-imidazol-4-ylmethyl)-4-phenyl-thiazole | CHEMBL38465
TypeSmall organic molecule
Emp. Form.C14H13N3S
Mol. Mass.255.338
SMILESCc1nc[nH]c1Cc1nc(cs1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: