Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine A2 receptor
LigandBDBM50094569
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30721
Ki 636±n/a nM
Citation Hutchison, AJWilliams, Mde Jesus, RYokoyama, ROei, HHGhai, GRWebb, RLZoganas, HCStone, GAJarvis, MF 2-(Arylalkylamino)adenosin-5'-uronamides: a new class of highly selective adenosine A2 receptor ligands. J Med Chem33:1919-24 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine A2 receptor
Name:Adenosine A2 receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 30560
Components:This complex has 2 components.
Component 1
Name:Adenosine receptor
Synonyms:Adora2b
Type:PROTEIN
Mol. Mass.:36378.84
Organism:Rattus norvegicus
Description:ChEMBL_32934
Residue:332
Sequence:
MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA
IPFAITISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT
RARGIIAVLWVLAFGIGLTPFLGWNSKDRATSNCTEPGDGITNKSCCPVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMMVIYIKIFMVACKQLQHMELMEHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYS
FHRIISRYVLCQTDTKGGSGQAGGQSTFSLSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Adenosine receptor A2a and A3
Synonyms:ADENOSINE A2a | Adenosine A2a receptor (A2a) | Adenosine receptors A2a | Rat striatal adenosine A2a receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:45015.65
Organism:Rattus norvegicus (rat)
Description:Rat A2A receptors expressed in CHO cells.
Residue:410
Sequence:
MGSSVYITVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFA
ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGVRAKG
IIAICWVLSFAIGLTPMLGWNNCSQKDGNSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAF
VLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALC
WLPLHIINCFTFFCSTCRHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRT
HVLRRQEPFQAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSATHSGRRPNGYTLGL
GGGGSAQGSPRDVELPTQERQEGQEHPGLRGHLVQARVGASSWSSEFAPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50094569
NameBDBM50094569
Synonyms:6-chloro-3,20-dioxo-1beta,2beta-dihydro-3'H-cyclopropa[1,2]pregna-4,6-dien-17-yl acetate | CHEMBL139835 | Cyproterone 17-O-acetate | cid_9880 | cyproterone acetate
TypeSmall organic molecule
Emp. Form.C24H29ClO4
Mol. Mass.416.938
SMILESCC(=O)O[C@@]1(CC[C@H]2[C@@H]3C=C(Cl)C4=CC(=O)[C@@H]5C[C@@H]5[C@]4(C)[C@H]3CC[C@]12C)C(C)=O |t:9,12|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a