Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50041245
Substrate/Competitorn/a
Meas. Tech.ChEBML_201270
Ki 31±n/a nM
Citation Glennon, RASmith, JDIsmaiel, AMel-Ashmawy, MBattaglia, GFischer, JB Identification and exploitation of the sigma-opiate pharmacophore. J Med Chem34:1094-8 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma opioid receptor
Synonyms:Aging-associated gene 8 protein | SIG-1R | SR-BP | SR31747-binding protein | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1
Type:Enzyme Catalytic Domain
Mol. Mass.:25124.85
Organism:Homo sapiens (Human)
Description:Sigma 0 HUMAN::Q99720
Residue:223
Sequence:
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50041245
NameBDBM50041245
Synonyms:((S)-1-Methyl-2-phenyl-ethyl)-phenethyl-amine | CHEMBL20804
TypeSmall organic molecule
Emp. Form.C17H21N
Mol. Mass.239.3553
SMILESC[C@@H](Cc1ccccc1)NCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a