Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetmu/kappa opioid receptor
LigandBDBM50009129
Substrate/Competitorn/a
Meas. Tech.ChEMBL_145153
Ki 18±n/a nM
Citation Portoghese, PSGarzon-Aburbeh, ANagase, HLin, CETakemori, AE Role of the spacer in conferring kappa opioid receptor selectivity to bivalent ligands related to norbinaltorphimine. J Med Chem34:1292-6 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
mu/kappa opioid receptor
Name:mu/kappa opioid receptor
Synonyms:Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:OPIATE Mu OPRM1 GUINEA PIG::P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009129
NameBDBM50009129
Synonyms:binaltorphimine(BNI)
TypeSmall organic molecule
Emp. Form.C41H45N3O6
Mol. Mass.675.8125
SMILESCn1c2[C@@H]3Oc4c5c(CC6N(CC7CC7)CC[C@@]35[C@@]6(O)Cc2c2C[C@@]3(O)C5Cc6ccc(O)c7O[C@@H](c12)[C@]3(CCN5CC1CC1)c67)ccc4O |TLB:46:7:18:10.16.15,5:6:18:10.16.15,THB:29:28:24:40.38.39,33:45:24:40.38.39|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a