Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM196
Substrate/Competitorn/a
Meas. Tech.ChEMBL_159774
IC50 3±n/a nM
Citation Huff, JR HIV protease: a novel chemotherapeutic target for AIDS. J Med Chem34:2305-14 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM196
NameBDBM196
Synonyms:A-74704 | CHEMBL307193 | benzyl N-[(1S)-1-{[(2S,4S)-4-[(2S)-2-{[(benzyloxy)carbonyl]amino}-3-methylbutanamido]-3-hydroxy-1,5-diphenylpentan-2-yl]carbamoyl}-2-methylpropyl]carbamate
Typen/a
Emp. Form.C43H52N4O7
Mol. Mass.736.8956
SMILESCC(C)[C@H](NC(=O)OCc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)OCc1ccccc1)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a