Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C (PKC)
LigandBDBM50009723
Substrate/Competitorn/a
Meas. Tech.ChEMBL_162362
IC50 19000±n/a nM
Citation Shearer, BGSullivan, JPCarter, JPMathew, RMWaid, PConnor, JRPatch, RJBurch, RM Substituted 2-(aminomethyl)piperidines: a novel class of selective protein kinase C inhibitors. J Med Chem34:2928-31 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C (PKC)
Name:Protein kinase C (PKC)
Synonyms:Protein kinase C alpha type
Type:Protein
Mol. Mass.:76797.67
Organism:Rattus norvegicus (Rat)
Description:P05696
Residue:672
Sequence:
MADVYPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVE
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009723
NameBDBM50009723
Synonyms:2,6-Diamino-hexanoic acid (1-tridecanoyl-piperidin-2-ylmethyl)-amide | CHEMBL329705
TypeSmall organic molecule
Emp. Form.C25H50N4O2
Mol. Mass.438.6901
SMILESCCCCCCCCCCCCC(=O)N1CCCCC1CNC(=O)[C@@H](N)CCCCN
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a