Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetArachidonate 5-lipoxygenase
LigandBDBM50000832
Substrate/Competitorn/a
Meas. Tech.ChEBML_3807
IC50 500±n/a nM
Citation Crawley, GCDowell, RIEdwards, PNFoster, SJMcMillan, RMWalker, ERWaterson, DBird, TGBruneau, PGiroaeau, JM Methoxytetrahydropyrans. A new series of selective and orally potent 5-lipoxygenase inhibitors. J Med Chem35:2600-9 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Arachidonate 5-lipoxygenase
Name:Arachidonate 5-lipoxygenase
Synonyms:5-LO | 5-Lipo-oxygenase (5-LOX) | 5-Lipoxygenase (5-LO) | 5-Lipoxygenase (LOX) | 5-Lipoygenase | ALOX5 | LOG5
Type:Enzyme
Mol. Mass.:77972.74
Organism:Homo sapiens (human)
Description:Recombinant protein was purified from E. coli lysate. After ammonium sulfate precipitation and subsequent steps, the supernatant (S100) was used for 5-LO activity assay.
Residue:674
Sequence:
MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE
ELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLA
RDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL
NYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNG
CNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP
CTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDF
HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECG
LFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWE
AIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYL
TVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW
HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPY
YYLSPDRIPNSVAI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50000832
NameBDBM50000832
Synonyms:2-{1-Methoxy-1-[3-(naphthalen-2-ylmethoxy)-phenyl]-ethyl}-thiazole | CHEMBL70191
TypeSmall organic molecule
Emp. Form.C23H21NO2S
Mol. Mass.375.483
SMILESCOC(C)(c1nccs1)c1cccc(OCc2ccc3ccccc3c2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a